(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1057

AL596167.LIN1057     Location/Qualifiers
FT   CDS             complement(109900..110130)
FT                   /transl_table=11
FT                   /gene="lin1057"
FT                   /note="similar to B. subtilis YlaI protein"
FT                   /db_xref="InterPro:IPR019241"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW4"
FT                   /protein_id="CAC96288.1"
FT                   /translation="MNAKCILCERVDELDNREFKTKQLRNKPIRMYLCPECEHRVAIKT
FT                   ISRVNSGHFNFHKPVVMSNSELKNLIESTEK"
     MNAKCILCER VDELDNREFK TKQLRNKPIR MYLCPECEHR VAIKTISRVN SGHFNFHKPV        60
     VMSNSELKNL IESTEK                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page