(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1058

AL596167.LIN1058     Location/Qualifiers
FT   CDS             110336..110617
FT                   /transl_table=11
FT                   /gene="lin1058"
FT                   /note="similar to B. subtilis YlaN protein"
FT                   /db_xref="InterPro:IPR009983"
FT                   /db_xref="InterPro:IPR036270"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CW3"
FT                   /protein_id="CAC96289.1"
FT                   /translation="MANKKIDHREEAIELLKQDAKRILQLIKVQMDNLTLPQCPAYEEV
FT                   LDTQMYGLSREINFATRLGLIEPEEGKKLISTLEKELSALHELSMSKK"
     MANKKIDHRE EAIELLKQDA KRILQLIKVQ MDNLTLPQCP AYEEVLDTQM YGLSREINFA        60
     TRLGLIEPEE GKKLISTLEK ELSALHELSM SKK                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page