(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1059

AL596167.LIN1059     Location/Qualifiers
FT   CDS             110790..111992
FT                   /transl_table=11
FT                   /gene="lin1059"
FT                   /note="similar to cell-division protein RodA and FtsW"
FT                   /db_xref="GOA:Q92CW2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW2"
FT                   /protein_id="CAC96290.1"
FT                   /translation="MLKRILKSYDYAFIAVFIVLCLFGIIMIYSASWSLAIGKDLPADY
FT                   YYARQVKNFIISFIFFVLFALIPFKFYQNNKVLMLIVFGSIGVLLLIFLVGKTVNNANS
FT                   WLVVGPRSLQPGEFAKLAVIIYMSAIYAKKQSYIDDFNRGVLPPIFFLAFVCFLIAIQP
FT                   DTGTAFIIFLVGCCIIIASGMRLRTIMKLIGIGVGVIVALTLILFALPDKVRTEIVSPT
FT                   KVARITTFMNPFEYADKEGHQLINSFYAIGSGGVSGQGLGESVQKLGYLPEAHTDFIIA
FT                   VVAEELGVFGVMFIILALFFIIFKTISTGLRAKDPFASLMCYGIASLIAIQAFINLGGA
FT                   SGLIPLTGVTLPFISYGGSSLMVLSMMLGIVANISMFNKYHRLYSADGSKKEVPKKQKR
FT                   R"
     MLKRILKSYD YAFIAVFIVL CLFGIIMIYS ASWSLAIGKD LPADYYYARQ VKNFIISFIF        60
     FVLFALIPFK FYQNNKVLML IVFGSIGVLL LIFLVGKTVN NANSWLVVGP RSLQPGEFAK       120
     LAVIIYMSAI YAKKQSYIDD FNRGVLPPIF FLAFVCFLIA IQPDTGTAFI IFLVGCCIII       180
     ASGMRLRTIM KLIGIGVGVI VALTLILFAL PDKVRTEIVS PTKVARITTF MNPFEYADKE       240
     GHQLINSFYA IGSGGVSGQG LGESVQKLGY LPEAHTDFII AVVAEELGVF GVMFIILALF       300
     FIIFKTISTG LRAKDPFASL MCYGIASLIA IQAFINLGGA SGLIPLTGVT LPFISYGGSS       360
     LMVLSMMLGI VANISMFNKY HRLYSADGSK KEVPKKQKRR                             400
//

If you have problems or comments...

PBIL Back to PBIL home page