(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1061

AL596167.LIN1061     Location/Qualifiers
FT   CDS             115860..116753
FT                   /transl_table=11
FT                   /gene="lin1061"
FT                   /note="similar to metal binding protein (ABC transporter)"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CW0"
FT                   /protein_id="CAC96292.1"
FT                   /translation="MKWFKGIAVALLLVILTACGNTETKAPTEKTKKIEVKDATEQKIT
FT                   LKEAPTKIVSLIPSNTEILFALDLGDKVKGVSAYDDYPKEAQKIEKVTSTTVDTEKIIA
FT                   LKPDLVLGHESMLATEKDAYQLLKDAGINVFVVPDATNLKEVENSIETIGKLTGKEQKA
FT                   KDVTASMEKQKAAVEKKVKELKTSPKVWIEISPDLYTAGKGTFMNEMLELAGGTNIVTE
FT                   TGFIPYNEEKVVELKPDIILSVYPDAKATILKRAAWKDLPAVKNEQIFEMDANKLSRPG
FT                   PRLLEGAADIQAVFEN"
     MKWFKGIAVA LLLVILTACG NTETKAPTEK TKKIEVKDAT EQKITLKEAP TKIVSLIPSN        60
     TEILFALDLG DKVKGVSAYD DYPKEAQKIE KVTSTTVDTE KIIALKPDLV LGHESMLATE       120
     KDAYQLLKDA GINVFVVPDA TNLKEVENSI ETIGKLTGKE QKAKDVTASM EKQKAAVEKK       180
     VKELKTSPKV WIEISPDLYT AGKGTFMNEM LELAGGTNIV TETGFIPYNE EKVVELKPDI       240
     ILSVYPDAKA TILKRAAWKD LPAVKNEQIF EMDANKLSRP GPRLLEGAAD IQAVFEN          297
//

If you have problems or comments...

PBIL Back to PBIL home page