(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1062

AL596167.LIN1062     Location/Qualifiers
FT   CDS             117035..117838
FT                   /transl_table=11
FT                   /gene="lin1062"
FT                   /note="highly similar to teichoic acid translocation
FT                   permease protein TagG "
FT                   /db_xref="GOA:Q92CV9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CV9"
FT                   /protein_id="CAC96293.1"
FT                   /translation="MKQVMEVIKEQIKNLPMIFRIARYEDKATYQSHYLGLAWQILNPL
FT                   IQIAIYYFVFGFGMNAKSGSDASYIEWMLAGIIPWFFISAVILQGANSIYNKIGMVSKM
FT                   NFPMSILPNITIVSNLTSYFTMMVILLGLLALNGTPVTIYWGQYLYYFVAMIAFLFSVT
FT                   LFNATISVLVRDYYIMLQSVMRVLFYVTGIVWNLETMLPQWLVHLLKLNPIYYVVNGFR
FT                   ETFLMNRGFWESPSYTMYFWLITLTLLFVGATLHMKFRERFVDYL"
     MKQVMEVIKE QIKNLPMIFR IARYEDKATY QSHYLGLAWQ ILNPLIQIAI YYFVFGFGMN        60
     AKSGSDASYI EWMLAGIIPW FFISAVILQG ANSIYNKIGM VSKMNFPMSI LPNITIVSNL       120
     TSYFTMMVIL LGLLALNGTP VTIYWGQYLY YFVAMIAFLF SVTLFNATIS VLVRDYYIML       180
     QSVMRVLFYV TGIVWNLETM LPQWLVHLLK LNPIYYVVNG FRETFLMNRG FWESPSYTMY       240
     FWLITLTLLF VGATLHMKFR ERFVDYL                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page