(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1063

AL596167.LIN1063     Location/Qualifiers
FT   CDS             117851..118858
FT                   /transl_table=11
FT                   /gene="lin1063"
FT                   /note="similar to teichoic acid translocation ATP-binding
FT                   protein TagH (ABC transporter)"
FT                   /db_xref="GOA:Q92CV8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015860"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CV8"
FT                   /protein_id="CAC96294.1"
FT                   /translation="MGKNIKIAFKHVSKEYDLYQNKSDKIKGLFMPKSQKMQSFWALRD
FT                   VSFDIHDGETVGLIGINGSGKSTISSIMSGVIPPTQGEVVINGETSLIAIAVGLKGPLT
FT                   GYENIRLKLLMHGMKSSQINKLMPSIIEFADIGDFINQPIKNYSSGMRSRLGFAISVHT
FT                   NPDILVIDEALSVGDQTFYEKCVNKINEFKARGKTIVFVSHSLGQVKSLCDRIIWMHHG
FT                   EIREMGEAKEVAQKYDEFVKWFNKQPNDYKKKYQKEHKEHQKAPQKKVYPNPNANKYRL
FT                   TLFDKFLLTALIVLTILFGTLVATGKSFKGLISETSTNQVEQIAYVDNNEITIR"
     MGKNIKIAFK HVSKEYDLYQ NKSDKIKGLF MPKSQKMQSF WALRDVSFDI HDGETVGLIG        60
     INGSGKSTIS SIMSGVIPPT QGEVVINGET SLIAIAVGLK GPLTGYENIR LKLLMHGMKS       120
     SQINKLMPSI IEFADIGDFI NQPIKNYSSG MRSRLGFAIS VHTNPDILVI DEALSVGDQT       180
     FYEKCVNKIN EFKARGKTIV FVSHSLGQVK SLCDRIIWMH HGEIREMGEA KEVAQKYDEF       240
     VKWFNKQPND YKKKYQKEHK EHQKAPQKKV YPNPNANKYR LTLFDKFLLT ALIVLTILFG       300
     TLVATGKSFK GLISETSTNQ VEQIAYVDNN EITIR                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page