(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1068

AL596167.LIN1068     Location/Qualifiers
FT   CDS             126847..129171
FT                   /transl_table=11
FT                   /gene="lin1068"
FT                   /note="similar to hypothetical protein 3 (capsulation
FT                   locus) of Haemophilus influenzae"
FT                   /db_xref="GOA:Q92CV3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CV3"
FT                   /protein_id="CAC96299.1"
FT                   /translation="MSKDSNKIIEQSREIGISIIMPLYNVEEVILETLESIHEQTFDSY
FT                   EVLLIDDGSTDKTIEIVTEYIKDKPRFKLYTQPNGGPASARNHGLRLAIGMYICFVDSD
FT                   DILPNYSLQLMYDGAISTGAKLITGATKRFNSEGEWFIPMHIQYNIAKPGMKTLLKNPE
FT                   LFYSIGPCAKLYHHSLIDGVFFPENIRYGEDQPFVLHALLQAKDIYTVEKVVYYYRLRD
FT                   GESQSLTQSVDKDPIRILKSVFQIFDYGEEELKKNNTDYEVALKYYQRVSSVELWGALR
FT                   AAIESKKSENQKIAFTMTLDWLKTKSDDFLNIIPSFRYFLLFSSIERVRYITKDNKENY
FT                   RNLIGYLWSRQGEEAKIAFRKTYPIPMKAALQIIENNNWRDARKISFKFIVRRKFKAPI
FT                   LIRKISRGIIFRIATLMPRKKNQVILATERSTTLEGNLLAIYDYMFYNNMPQKVYVFLR
FT                   KNRNWFEMFQLYYTLGRTKTIVLDDYYNKIYGLKFNKNTHVVQSWHATGAFKKFGFSAL
FT                   EGTDANTEEFETRAHSPYTDVLVSSEGIIPEYMEAFRKQANQIKPIGVPRTDVFFDDEY
FT                   VNYTKEKYMKMYPQLRDKKILLYAPTFRGGPNERFNYSVVLDIAALKKELGDTHILILK
FT                   FHPVIKNVSFNVEEDDPFILNLTLNNDINDLMLFSDALITDYSSVIFEFSLMNKPIYFF
FT                   AYDIDDYLDERGFYFDYKATIPGEVFRDTPSLIEAVKSGLYNYDELEIFKKKFVGSLDG
FT                   NSTKRFVETYIGKANEKVKDI"
     MSKDSNKIIE QSREIGISII MPLYNVEEVI LETLESIHEQ TFDSYEVLLI DDGSTDKTIE        60
     IVTEYIKDKP RFKLYTQPNG GPASARNHGL RLAIGMYICF VDSDDILPNY SLQLMYDGAI       120
     STGAKLITGA TKRFNSEGEW FIPMHIQYNI AKPGMKTLLK NPELFYSIGP CAKLYHHSLI       180
     DGVFFPENIR YGEDQPFVLH ALLQAKDIYT VEKVVYYYRL RDGESQSLTQ SVDKDPIRIL       240
     KSVFQIFDYG EEELKKNNTD YEVALKYYQR VSSVELWGAL RAAIESKKSE NQKIAFTMTL       300
     DWLKTKSDDF LNIIPSFRYF LLFSSIERVR YITKDNKENY RNLIGYLWSR QGEEAKIAFR       360
     KTYPIPMKAA LQIIENNNWR DARKISFKFI VRRKFKAPIL IRKISRGIIF RIATLMPRKK       420
     NQVILATERS TTLEGNLLAI YDYMFYNNMP QKVYVFLRKN RNWFEMFQLY YTLGRTKTIV       480
     LDDYYNKIYG LKFNKNTHVV QSWHATGAFK KFGFSALEGT DANTEEFETR AHSPYTDVLV       540
     SSEGIIPEYM EAFRKQANQI KPIGVPRTDV FFDDEYVNYT KEKYMKMYPQ LRDKKILLYA       600
     PTFRGGPNER FNYSVVLDIA ALKKELGDTH ILILKFHPVI KNVSFNVEED DPFILNLTLN       660
     NDINDLMLFS DALITDYSSV IFEFSLMNKP IYFFAYDIDD YLDERGFYFD YKATIPGEVF       720
     RDTPSLIEAV KSGLYNYDEL EIFKKKFVGS LDGNSTKRFV ETYIGKANEK VKDI             774
//

If you have problems or comments...

PBIL Back to PBIL home page