(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1073

AL596167.LIN1073     Location/Qualifiers
FT   CDS             133214..134602
FT                   /transl_table=11
FT                   /gene="lin1073"
FT                   /note="similar to galactosamine-containing minor teichoic
FT                   acid biosynthesis protein GgaA "
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU8"
FT                   /protein_id="CAC96304.1"
FT                   /translation="MKFAIIIPFYNAEKRLALSIDSIIKQTYSFLKHVEVLLINDGSTD
FT                   RSSAIAHSYAEKYPSNIRVFDVPNGGPSKARNIGIHNVQEDTDFVGFLDADDLLSPNML
FT                   FSMVNFLEKSAVNMLVPAFYYLDDFGKKQKISPHKLNDRFTNGNRVVAIEKEPQAIHFY
FT                   IGGTFFRFESLKQFVFDETLNFAEDQLLITKFLLENRSYGLIADAGYYYYRDLKQKGSL
FT                   VSSAWKQPERYTPFLQKVYQTYLTNSKEIFGEVIPYVQYLIAYHAKLFFYKENIYFKEV
FT                   LNEQEQEIFVRELQKILQEVGPEMIVALDTPLVVKEMMLSILRNGWPVQFKTAELEEVP
FT                   LVTVKENYRPGKAVTVELLLEEARETLSDGGEFFASTSVGTAQTKVVKRKTAQTIWDIV
FT                   VREEGTLEKVVTRLKPYQLKVQVFYQDKNQKITMTDLNVIKSVLGKLKRNKALKRKFKQ
FT                   GGVS"
     MKFAIIIPFY NAEKRLALSI DSIIKQTYSF LKHVEVLLIN DGSTDRSSAI AHSYAEKYPS        60
     NIRVFDVPNG GPSKARNIGI HNVQEDTDFV GFLDADDLLS PNMLFSMVNF LEKSAVNMLV       120
     PAFYYLDDFG KKQKISPHKL NDRFTNGNRV VAIEKEPQAI HFYIGGTFFR FESLKQFVFD       180
     ETLNFAEDQL LITKFLLENR SYGLIADAGY YYYRDLKQKG SLVSSAWKQP ERYTPFLQKV       240
     YQTYLTNSKE IFGEVIPYVQ YLIAYHAKLF FYKENIYFKE VLNEQEQEIF VRELQKILQE       300
     VGPEMIVALD TPLVVKEMML SILRNGWPVQ FKTAELEEVP LVTVKENYRP GKAVTVELLL       360
     EEARETLSDG GEFFASTSVG TAQTKVVKRK TAQTIWDIVV REEGTLEKVV TRLKPYQLKV       420
     QVFYQDKNQK ITMTDLNVIK SVLGKLKRNK ALKRKFKQGG VS                          462
//

If you have problems or comments...

PBIL Back to PBIL home page