(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1074

AL596167.LIN1074     Location/Qualifiers
FT   CDS             134602..135756
FT                   /transl_table=11
FT                   /gene="lin1074"
FT                   /note="similar to B. subtilis TagF protein (probable
FT                   CDPglycerol glycerophosphotransferase)"
FT                   /db_xref="GOA:Q92CU7"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU7"
FT                   /protein_id="CAC96305.1"
FT                   /translation="MKFVQKIYYFLFKLVGFLPRRKELVMFESFSGKQYSCNPRAIFEY
FT                   MEEHNPEYELLWSVNPKYVDLFEAHGVPYVKRFSVNWLFKMGLAKFWISNSRLPLELPK
FT                   PKKTIYVQTWHGTPLKKLGVDIDEVHMPGQTTEQYKADFVKEAQKWDYLISPNAYSSTI
FT                   FRRAFGFTGEMIESGYPRNDILFSADKELKIANIKMALNIPEDKKVILYAPTWRDNDFY
FT                   EIGKYKFDLKIDIAKMQEKFGDEVVLLVRMHYLVAEHFDFTQYGDFVRDASKHEDIRDL
FT                   YLVSDLLITDYSSVFFDYANLKRPMLFYTYDLAEYRDTLRGFYFDFEQNAPGPLVEMND
FT                   ALMAEIEIMLENPPQIAESFLEQFCTWEDGHAAEKTVKKVFAEK"
     MKFVQKIYYF LFKLVGFLPR RKELVMFESF SGKQYSCNPR AIFEYMEEHN PEYELLWSVN        60
     PKYVDLFEAH GVPYVKRFSV NWLFKMGLAK FWISNSRLPL ELPKPKKTIY VQTWHGTPLK       120
     KLGVDIDEVH MPGQTTEQYK ADFVKEAQKW DYLISPNAYS STIFRRAFGF TGEMIESGYP       180
     RNDILFSADK ELKIANIKMA LNIPEDKKVI LYAPTWRDND FYEIGKYKFD LKIDIAKMQE       240
     KFGDEVVLLV RMHYLVAEHF DFTQYGDFVR DASKHEDIRD LYLVSDLLIT DYSSVFFDYA       300
     NLKRPMLFYT YDLAEYRDTL RGFYFDFEQN APGPLVEMND ALMAEIEIML ENPPQIAESF       360
     LEQFCTWEDG HAAEKTVKKV FAEK                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page