(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1075

AL596167.LIN1075     Location/Qualifiers
FT   CDS             135769..136920
FT                   /transl_table=11
FT                   /gene="lin1075"
FT                   /note="similar to teichoic acid biosynthesis protein B
FT                   precursor"
FT                   /db_xref="GOA:Q92CU6"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU6"
FT                   /protein_id="CAC96306.1"
FT                   /translation="MKKIAIYMYMLAVKIIGFLASLLPVQQKVVFLISFEENPTAIIKQ
FT                   MKLSNVTPKTIVFYDPRVDVSKLSLDFIKVKPKTLQQFIPLMFHLNTAKVVVTDNYFVE
FT                   LAGLKLRNGVNCIQVWHANGALKKFGWEDKAAQKRSDRDKKRFQEVYKRFTKVLVGSDE
FT                   MASIFKKSFLLDESNMLKLGVPRTDYFFKEAQLQENYQWSYEHLHLTNRIKLLYAPTFR
FT                   DNELGMAKLHLDIAEMKQALGNEYQLILKLHPSISNDLEKLDDDFVIYVDKETPIETLL
FT                   PVVDILITDYSSIPFEFALLQKPMIFFTYDLTEYNNARGLSDGFLETIPGPHVFTTTEL
FT                   IEVIQNNTFDLEKVRLFAEKWNKYSDGFSSERFVSFLKEQLEK"
     MKKIAIYMYM LAVKIIGFLA SLLPVQQKVV FLISFEENPT AIIKQMKLSN VTPKTIVFYD        60
     PRVDVSKLSL DFIKVKPKTL QQFIPLMFHL NTAKVVVTDN YFVELAGLKL RNGVNCIQVW       120
     HANGALKKFG WEDKAAQKRS DRDKKRFQEV YKRFTKVLVG SDEMASIFKK SFLLDESNML       180
     KLGVPRTDYF FKEAQLQENY QWSYEHLHLT NRIKLLYAPT FRDNELGMAK LHLDIAEMKQ       240
     ALGNEYQLIL KLHPSISNDL EKLDDDFVIY VDKETPIETL LPVVDILITD YSSIPFEFAL       300
     LQKPMIFFTY DLTEYNNARG LSDGFLETIP GPHVFTTTEL IEVIQNNTFD LEKVRLFAEK       360
     WNKYSDGFSS ERFVSFLKEQ LEK                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page