(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1077

AL596167.LIN1077     Location/Qualifiers
FT   CDS             137486..138976
FT                   /transl_table=11
FT                   /gene="lin1077"
FT                   /note="conserved hypothetical protein, similar to B.
FT                   subtilis YueK protein"
FT                   /db_xref="GOA:Q92CU4"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU4"
FT                   /protein_id="CAC96308.1"
FT                   /translation="MTNLFQDDSLTLHTDLYQLNMMKAYFDDGLHERRSVFEVFFRDMP
FT                   FDSGFVVFAGLERIINYMQNLRFTETDIAYLHDELGFDGPFLEYLRNFKFKGNILAAKE
FT                   GEFVFKTEPILQVEASLAEAQLIETALLNIVNFQTLIATKAARIRSVIDDETFAEFGTR
FT                   RAQEMDAAIWGTRAAYIGGCDSTSNVRAGKIFGIPVSGTMAHAMVQAYRDELEAFRSYA
FT                   KTHFDSIFLVDTYDTLKSGVPNAIKVAKEMGDKINFIGIRLDSGDMAFLSKKARQMLDE
FT                   AGFTEAKIFASSDLDEHTILSLKAQKAKIDSWGVGTKLITAYDQPALGAVYKMAAIADE
FT                   NDILQDSIKLSSNTEKVSTPGKKKVYRIITNEDGLKAEGDYIALADESLENVDKLTMFH
FT                   PVHTYIMKTVENFTARELLVPIFKDGELVYDMPTLDEIKAYKEENLALLWDEYKRTVRP
FT                   EQYPVDLSVKCWKNKMRNIEKVRKSVQLHSPVELDMPF"
     MTNLFQDDSL TLHTDLYQLN MMKAYFDDGL HERRSVFEVF FRDMPFDSGF VVFAGLERII        60
     NYMQNLRFTE TDIAYLHDEL GFDGPFLEYL RNFKFKGNIL AAKEGEFVFK TEPILQVEAS       120
     LAEAQLIETA LLNIVNFQTL IATKAARIRS VIDDETFAEF GTRRAQEMDA AIWGTRAAYI       180
     GGCDSTSNVR AGKIFGIPVS GTMAHAMVQA YRDELEAFRS YAKTHFDSIF LVDTYDTLKS       240
     GVPNAIKVAK EMGDKINFIG IRLDSGDMAF LSKKARQMLD EAGFTEAKIF ASSDLDEHTI       300
     LSLKAQKAKI DSWGVGTKLI TAYDQPALGA VYKMAAIADE NDILQDSIKL SSNTEKVSTP       360
     GKKKVYRIIT NEDGLKAEGD YIALADESLE NVDKLTMFHP VHTYIMKTVE NFTARELLVP       420
     IFKDGELVYD MPTLDEIKAY KEENLALLWD EYKRTVRPEQ YPVDLSVKCW KNKMRNIEKV       480
     RKSVQLHSPV ELDMPF                                                       496
//

If you have problems or comments...

PBIL Back to PBIL home page