(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1078

AL596167.LIN1078     Location/Qualifiers
FT   CDS             138988..139812
FT                   /transl_table=11
FT                   /gene="lin1078"
FT                   /note="similar to NH(3)-dependent NAD(+) synthetases,
FT                   nitrogen regulatory protein"
FT                   /db_xref="GOA:Q92CU3"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CU3"
FT                   /protein_id="CAC96309.1"
FT                   /translation="MEIRERILADMQVAETIDAHEEIRKSVEFLKAYLKKNTFLKSFVL
FT                   GISGGQDSTLTGKLAQMAISELRAETGDDEYQFFAVSLPYGTQLDESDRQDALDFMAPD
FT                   NRLTVNIKASVDASVAALAEAGVELSDFAKGNEKARERMKVQYAIAAMHKGVVVGTDHS
FT                   AEAVTGFYTKYGDGGTDINPLFRLNKRQGKALLKELGCPEHLYLKKPTADLEDNKPALP
FT                   DEVALGVTYDQIDDYLEGKEVPADAAAKIENWFIKTEHKRHMAITIFDDFWK"
     MEIRERILAD MQVAETIDAH EEIRKSVEFL KAYLKKNTFL KSFVLGISGG QDSTLTGKLA        60
     QMAISELRAE TGDDEYQFFA VSLPYGTQLD ESDRQDALDF MAPDNRLTVN IKASVDASVA       120
     ALAEAGVELS DFAKGNEKAR ERMKVQYAIA AMHKGVVVGT DHSAEAVTGF YTKYGDGGTD       180
     INPLFRLNKR QGKALLKELG CPEHLYLKKP TADLEDNKPA LPDEVALGVT YDQIDDYLEG       240
     KEVPADAAAK IENWFIKTEH KRHMAITIFD DFWK                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page