(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1092

AL596167.LIN1092     Location/Qualifiers
FT   CDS             149550..150002
FT                   /transl_table=11
FT                   /gene="lin1092"
FT                   /note="similar to E. coli YjaB protein"
FT                   /db_xref="GOA:Q92CS9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CS9"
FT                   /protein_id="CAC96323.1"
FT                   /translation="MILINKRAEKQDYQTILAIWEKSVIVTHDFLTAEDRQFYKEQIPL
FT                   FLDNVELFLWFAGEEVIGFSGTSERELDMLFLDPVATGNGYGSQILGWLIENKRINLVD
FT                   VNEQNENATRFYLKHGFVVSSRSDLDGFGKPYPILQLQLKERVNGV"
     MILINKRAEK QDYQTILAIW EKSVIVTHDF LTAEDRQFYK EQIPLFLDNV ELFLWFAGEE        60
     VIGFSGTSER ELDMLFLDPV ATGNGYGSQI LGWLIENKRI NLVDVNEQNE NATRFYLKHG       120
     FVVSSRSDLD GFGKPYPILQ LQLKERVNGV                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page