(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1101

AL596167.LIN1101     Location/Qualifiers
FT   CDS             158071..159624
FT                   /transl_table=11
FT                   /gene="lin1101"
FT                   /note="similar to internalin, putative peptidoglycan bound
FT                   protein (LPXTG motif)"
FT                   /db_xref="GOA:Q92CS0"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR024634"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CS0"
FT                   /protein_id="CAC96332.1"
FT                   /translation="MKKTIKITTSLLLSFACVFSVGDFTKPHTVEAETVYSLTNPKPIN
FT                   EIFSDPKLAQVVADWLKLPSATSAVTQSQLNTVKSLHFDSKGVQSLEGVEYLKNLTQVF
FT                   GYGNQVSDLGPLSNLTQLEIIQMPRNQISDLTPISNLTALMSLDFEFNNLQTIEPIKNL
FT                   TNMLELNVSANPISDISAVKNMTQLEFLTIRDCEVSDLSPVENLSNMLMFWAGRNNISD
FT                   ITPLKNMPKLLGLSLFGNQIKDVSVVKNLTSLEDFDLKANQVSDISSLATSTTLETLTL
FT                   SFNQIIDISPLKNLTNLTRLELENQTRVLDAVEVDNPLILPAPVIDENGSRVQPTKVSH
FT                   AGIYANGEITWEGLQSNYILNYEYNLPVAIGSLTTTYSGKITQPLLEKPVDPITPVDPV
FT                   DPVDPVDPVDPVDPVDPVDPVDPVDPVDPVDPVDPIDPVNPVDPITPVDPSNQVNSTDP
FT                   VKSVLQATETLIKQTISVNPIVAKDNRNLPKTGDSGMTSSLVGGLILAVSSLVLLRKRK
FT                   "
     MKKTIKITTS LLLSFACVFS VGDFTKPHTV EAETVYSLTN PKPINEIFSD PKLAQVVADW        60
     LKLPSATSAV TQSQLNTVKS LHFDSKGVQS LEGVEYLKNL TQVFGYGNQV SDLGPLSNLT       120
     QLEIIQMPRN QISDLTPISN LTALMSLDFE FNNLQTIEPI KNLTNMLELN VSANPISDIS       180
     AVKNMTQLEF LTIRDCEVSD LSPVENLSNM LMFWAGRNNI SDITPLKNMP KLLGLSLFGN       240
     QIKDVSVVKN LTSLEDFDLK ANQVSDISSL ATSTTLETLT LSFNQIIDIS PLKNLTNLTR       300
     LELENQTRVL DAVEVDNPLI LPAPVIDENG SRVQPTKVSH AGIYANGEIT WEGLQSNYIL       360
     NYEYNLPVAI GSLTTTYSGK ITQPLLEKPV DPITPVDPVD PVDPVDPVDP VDPVDPVDPV       420
     DPVDPVDPVD PVDPIDPVNP VDPITPVDPS NQVNSTDPVK SVLQATETLI KQTISVNPIV       480
     AKDNRNLPKT GDSGMTSSLV GGLILAVSSL VLLRKRK                                517
//

If you have problems or comments...

PBIL Back to PBIL home page