(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1106

AL596167.LIN1106     Location/Qualifiers
FT   CDS             161867..163231
FT                   /transl_table=11
FT                   /gene="lin1106"
FT                   /note="similar to Salmonella enterica PduS protein"
FT                   /db_xref="GOA:Q92CR5"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017054"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR5"
FT                   /protein_id="CAC96337.1"
FT                   /translation="MSQMSILEKIKDAGVVGCGGAGFPTHAKFSGEVEYLIINAAECEP
FT                   LLKTDHFVMRNHAVETIKAIEMVKNQVGAEFAVIATKRYYTEEIAALRSAITELNASVT
FT                   IHEMDNVYPTGDEQVMVFEVTGRVVPPSGIPLMVGCIVSNVSTMWNVFHAIQDDAPVIR
FT                   KQLTVTGAVGEPKLLDVPVGTPFEVCLAAAGGTNLDEYLFLDGGPMMGKLNDQSTIAEK
FT                   VVTKTTSGLIVAEDTGYLHKLHYQTVEQIFNETKSACIQCSLCSDLCPRQQLGHDIHPH
FT                   KVMRHFAVAEDITDIKPDPIWEEAMICCECGICEVIACPMGLSPRQVNIHVKKELLKQG
FT                   VRYQTDKKEFTPDPMRDYKSIAPKNILIKMGLQQYADVHLETMHYLDVDEVFIPTKMHI
FT                   GAPSIPVVSEGDIVKKGDLIAKIPDTALGANIHASIDGQIIRITEEQVHIKRVMS"
     MSQMSILEKI KDAGVVGCGG AGFPTHAKFS GEVEYLIINA AECEPLLKTD HFVMRNHAVE        60
     TIKAIEMVKN QVGAEFAVIA TKRYYTEEIA ALRSAITELN ASVTIHEMDN VYPTGDEQVM       120
     VFEVTGRVVP PSGIPLMVGC IVSNVSTMWN VFHAIQDDAP VIRKQLTVTG AVGEPKLLDV       180
     PVGTPFEVCL AAAGGTNLDE YLFLDGGPMM GKLNDQSTIA EKVVTKTTSG LIVAEDTGYL       240
     HKLHYQTVEQ IFNETKSACI QCSLCSDLCP RQQLGHDIHP HKVMRHFAVA EDITDIKPDP       300
     IWEEAMICCE CGICEVIACP MGLSPRQVNI HVKKELLKQG VRYQTDKKEF TPDPMRDYKS       360
     IAPKNILIKM GLQQYADVHL ETMHYLDVDE VFIPTKMHIG APSIPVVSEG DIVKKGDLIA       420
     KIPDTALGAN IHASIDGQII RITEEQVHIK RVMS                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page