(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1107

AL596167.LIN1107     Location/Qualifiers
FT   CDS             163228..163782
FT                   /transl_table=11
FT                   /gene="lin1107"
FT                   /note="similar to Salmonella enterica PduT protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR011238"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR4"
FT                   /protein_id="CAC96338.1"
FT                   /translation="MKMDTLGFLELNSISKGIEAVDTMLKAANSELIYAKASCPGKYYI
FT                   LIAGTVDSVAQSIEAGTKIGAANIVGNLVIPRVSDQVIKAINKTEVPDEMNAVGVMEYY
FT                   SCSGSIIAADAAVKAADVQLMDIRLATGIAGKSFVVLTGDTAACEAAVEAGLAAAKEEA
FT                   LLINKVVIPRPRKEVFESLIY"
     MKMDTLGFLE LNSISKGIEA VDTMLKAANS ELIYAKASCP GKYYILIAGT VDSVAQSIEA        60
     GTKIGAANIV GNLVIPRVSD QVIKAINKTE VPDEMNAVGV MEYYSCSGSI IAADAAVKAA       120
     DVQLMDIRLA TGIAGKSFVV LTGDTAACEA AVEAGLAAAK EEALLINKVV IPRPRKEVFE       180
     SLIY                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page