(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1108

AL596167.LIN1108     Location/Qualifiers
FT   CDS             163930..164280
FT                   /transl_table=11
FT                   /gene="lin1108"
FT                   /note="similar to Salmonelle enterica PduU protein"
FT                   /db_xref="GOA:Q92CR3"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009307"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR3"
FT                   /protein_id="CAC96339.1"
FT                   /translation="MSFDDNKERVIQEYVPGKQVTLAHLIANPNRDIYTKLGLEEGASA
FT                   IGILTITPSEASIIASDIATKSGDVRIGFIDRFSGSVVLTGDVSSVESALQQVVYSLHE
FT                   ILDFSIPKITRS"
     MSFDDNKERV IQEYVPGKQV TLAHLIANPN RDIYTKLGLE EGASAIGILT ITPSEASIIA        60
     SDIATKSGDV RIGFIDRFSG SVVLTGDVSS VESALQQVVY SLHEILDFSI PKITRS           116
//

If you have problems or comments...

PBIL Back to PBIL home page