(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1109

AL596167.LIN1109     Location/Qualifiers
FT   CDS             164286..164717
FT                   /transl_table=11
FT                   /gene="lin1109"
FT                   /note="similar to Salmonella enterica PduV protein"
FT                   /db_xref="GOA:Q92CR2"
FT                   /db_xref="InterPro:IPR012381"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR2"
FT                   /protein_id="CAC96340.1"
FT                   /translation="MKKMMVMGSVGCGKTTLCQKLHGYDILYKKTQAVEYFQEMIDTPG
FT                   EFVQHRQLYSALTVTSADASVIAILQSVTEKKQTFSPMFASIFAKPVIGIVTKVDLAES
FT                   DKDIERAERELRMAGAKHIFYISSVEETGIEELRAYLED"
     MKKMMVMGSV GCGKTTLCQK LHGYDILYKK TQAVEYFQEM IDTPGEFVQH RQLYSALTVT        60
     SADASVIAIL QSVTEKKQTF SPMFASIFAK PVIGIVTKVD LAESDKDIER AERELRMAGA       120
     KHIFYISSVE ETGIEELRAY LED                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page