(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1111

AL596167.LIN1111     Location/Qualifiers
FT   CDS             165478..166035
FT                   /transl_table=11
FT                   /gene="lin1111"
FT                   /note="similar to bifunctional cobalamin biosynthesis
FT                   protein CopB, (cobinamide kinase; cobinamide phosphatase
FT                   guanylyltransferase)"
FT                   /db_xref="GOA:Q92CR0"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CR0"
FT                   /protein_id="CAC96342.1"
FT                   /translation="MAEMMLVTGGARSGKSNFAEKEAAKYDRVLYVATGIAFQNDTEFQ
FT                   ARIKKHQATRPEHWDTFEAFKGIATYLEQHGNQYDVIMLDCVTMLVTNLFFSLLGEREL
FT                   TNEIADEVEAAIQSEVRAILKAGKQSSAKLIFVTNEIGLGVVPENKLTRVFRDIIGRIN
FT                   QQIATEVEEVYFVVSGIPKRWK"
     MAEMMLVTGG ARSGKSNFAE KEAAKYDRVL YVATGIAFQN DTEFQARIKK HQATRPEHWD        60
     TFEAFKGIAT YLEQHGNQYD VIMLDCVTML VTNLFFSLLG ERELTNEIAD EVEAAIQSEV       120
     RAILKAGKQS SAKLIFVTNE IGLGVVPENK LTRVFRDIIG RINQQIATEV EEVYFVVSGI       180
     PKRWK                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page