(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1114

AL596167.LIN1114     Location/Qualifiers
FT   CDS             complement(167770..168654)
FT                   /transl_table=11
FT                   /gene="lin1114"
FT                   /product="Regulatory protein similar to Salmonella
FT                   typhimurium PocR protein"
FT                   /db_xref="GOA:Q92CQ7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR018771"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ7"
FT                   /protein_id="CAC96345.1"
FT                   /translation="MLLQTKSNEMLLEKVMDEFSAATSLASVVVDIHGTEVSRLCNFTP
FT                   FCQLIRSNPKYRSLCQKCDMFGGLEASKTGKPLIYRCHAGLTDFSVPIVVENQLSGFLL
FT                   SGQVICEENSEVGNIQTEETDWKNDKDLISAFRSVPVFSSKKINSSAEMLTIISQYYLK
FT                   SEMEKSREEQKQKIVFHHNKPTHHEDNKEIRKALKYIEKNLNRPITLDEVASHVYLSSY
FT                   YFSKLFKKEMNVNFINYVNQKKMSLAKDMLKNPRWSIDNVARNLGFTQTSYFCKVFRKE
FT                   FDVTPKGYRETLK"
     MLLQTKSNEM LLEKVMDEFS AATSLASVVV DIHGTEVSRL CNFTPFCQLI RSNPKYRSLC        60
     QKCDMFGGLE ASKTGKPLIY RCHAGLTDFS VPIVVENQLS GFLLSGQVIC EENSEVGNIQ       120
     TEETDWKNDK DLISAFRSVP VFSSKKINSS AEMLTIISQY YLKSEMEKSR EEQKQKIVFH       180
     HNKPTHHEDN KEIRKALKYI EKNLNRPITL DEVASHVYLS SYYFSKLFKK EMNVNFINYV       240
     NQKKMSLAKD MLKNPRWSID NVARNLGFTQ TSYFCKVFRK EFDVTPKGYR ETLK             294
//

If you have problems or comments...

PBIL Back to PBIL home page