(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1115

AL596167.LIN1115     Location/Qualifiers
FT   CDS             168956..169243
FT                   /transl_table=11
FT                   /gene="lin1115"
FT                   /note="similar to Salmonella typhimurium PduA protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ6"
FT                   /protein_id="CAC96346.1"
FT                   /translation="MQEALGLVETKGLVSAIEAADAMVKSANVTLTGYEKIGSGLVTVM
FT                   VRGDVGAVKAATDAGAEAARNVGTVMSTHVIPRPHTDVEEILPVRVKSDE"
     MQEALGLVET KGLVSAIEAA DAMVKSANVT LTGYEKIGSG LVTVMVRGDV GAVKAATDAG        60
     AEAARNVGTV MSTHVIPRPH TDVEEILPVR VKSDE                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page