(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1116

AL596167.LIN1116     Location/Qualifiers
FT   CDS             169236..170039
FT                   /transl_table=11
FT                   /gene="lin1116"
FT                   /note="similar to Salmonella typhimurium PduB protein"
FT                   /db_xref="GOA:Q92CQ5"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030984"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ5"
FT                   /protein_id="CAC96347.1"
FT                   /translation="MSKQNKLIDEILKQVMETVNDAPEKIVEDGGSRQMSEKAVQLTEF
FT                   VGTAIGDTIGLVIANVDGQLLEAMKLEKSYRSIGILGARTGAGPHIMAADEAVKATNTE
FT                   VVKIELPRDTKGGAGHGSLIIFGGDDVSDVKRAVEVALNELDKTFGDVYGNEAGHIELQ
FT                   YTARASHALNTAFGAPVGKAFGLMVGAPAGIGVVMADTAVKSANVDVVAYSSPADGTSF
FT                   SNEVILCISGDSGAVRQAVISAREIGKKLLGALGDEPKNDRPSYI"
     MSKQNKLIDE ILKQVMETVN DAPEKIVEDG GSRQMSEKAV QLTEFVGTAI GDTIGLVIAN        60
     VDGQLLEAMK LEKSYRSIGI LGARTGAGPH IMAADEAVKA TNTEVVKIEL PRDTKGGAGH       120
     GSLIIFGGDD VSDVKRAVEV ALNELDKTFG DVYGNEAGHI ELQYTARASH ALNTAFGAPV       180
     GKAFGLMVGA PAGIGVVMAD TAVKSANVDV VAYSSPADGT SFSNEVILCI SGDSGAVRQA       240
     VISAREIGKK LLGALGDEPK NDRPSYI                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page