(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1117

AL596167.LIN1117     Location/Qualifiers
FT   CDS             170058..171722
FT                   /transl_table=11
FT                   /gene="lin1117"
FT                   /note="highly similar to propanediol dehydratase, alpha
FT                   subunit"
FT                   /db_xref="GOA:Q92CQ4"
FT                   /db_xref="InterPro:IPR003206"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036999"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ4"
FT                   /protein_id="CAC96348.1"
FT                   /translation="MKSKRFEELAKRPVNQDGFVKEWIEEGLIAMESPNDPKPSIKIEN
FT                   GKVVEMDSKKLADFDLIDHFIAKYGVDLSRAEEVMKMDSVKLANMLCDPNVPREKIVLL
FT                   TTAMTPAKIVEVVSQMNVVEMMMSMQKMRSRRTPTTQAHVTNLRDNPVQIAADAAEAAI
FT                   RGFDEQETTVAVVRYAPFNALSLLVGSQTGRGGVLTQCSLEEATELELGMRGLTCYAET
FT                   ISVYGTEPVFTDGDDTPWSKGILASAYASRGLKMRFTSGTGSEVQMGYAEGKSMLYLES
FT                   RCIFITKAAGVQGLQNGSISCIGIPGAVPSGIRAVLAENLIAVMLDLEVASGNDQTFSH
FT                   SDIRRTARLLMQFLPGTDYISSGYSATPNYDNMFAGSNFDADDFDDYNILQRDLKVDGG
FT                   LTPVTEEEVVAVRNKAARVIQVVFDKLGLPAVTDEEVEAATYARGSNDMPERNMVEDIK
FT                   AAAEMMDRGVTGLDVVKALAAGGFDDVAESVLNMLKQRVSGDFLHTSAIIDKDWNVISS
FT                   VNDLNDYAGPGTGYRLEGERWEKLKDIAVAVDANELD"
     MKSKRFEELA KRPVNQDGFV KEWIEEGLIA MESPNDPKPS IKIENGKVVE MDSKKLADFD        60
     LIDHFIAKYG VDLSRAEEVM KMDSVKLANM LCDPNVPREK IVLLTTAMTP AKIVEVVSQM       120
     NVVEMMMSMQ KMRSRRTPTT QAHVTNLRDN PVQIAADAAE AAIRGFDEQE TTVAVVRYAP       180
     FNALSLLVGS QTGRGGVLTQ CSLEEATELE LGMRGLTCYA ETISVYGTEP VFTDGDDTPW       240
     SKGILASAYA SRGLKMRFTS GTGSEVQMGY AEGKSMLYLE SRCIFITKAA GVQGLQNGSI       300
     SCIGIPGAVP SGIRAVLAEN LIAVMLDLEV ASGNDQTFSH SDIRRTARLL MQFLPGTDYI       360
     SSGYSATPNY DNMFAGSNFD ADDFDDYNIL QRDLKVDGGL TPVTEEEVVA VRNKAARVIQ       420
     VVFDKLGLPA VTDEEVEAAT YARGSNDMPE RNMVEDIKAA AEMMDRGVTG LDVVKALAAG       480
     GFDDVAESVL NMLKQRVSGD FLHTSAIIDK DWNVISSVND LNDYAGPGTG YRLEGERWEK       540
     LKDIAVAVDA NELD                                                         554
//

If you have problems or comments...

PBIL Back to PBIL home page