(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1118

AL596167.LIN1118     Location/Qualifiers
FT   CDS             171760..172419
FT                   /transl_table=11
FT                   /gene="lin1118"
FT                   /note="similar to diol dehydrase (diol dehydratase) gamma
FT                   subunit"
FT                   /db_xref="InterPro:IPR003208"
FT                   /db_xref="InterPro:IPR010254"
FT                   /db_xref="InterPro:IPR025541"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ3"
FT                   /protein_id="CAC96349.1"
FT                   /translation="MVEINEKVLRGIISEVLDELQLKEDKVSFQKEQPSVAVSDESFLT
FT                   EVGDAKPGRQKDEVVIAVAPAFGKYQTKNIVGVPHKQILREVIAGIEEEGLKARVVRVF
FT                   RSSDVAFVAVEGDKLSGSGICIGIQSRGTALIHQKDLQPLSNLELFPQAPLITLETYRA
FT                   IGKNAAKYAKGESPNPVPMVNDQMARPKFQAKAALLHIKETKHVVQGKNAVELQVN"
     MVEINEKVLR GIISEVLDEL QLKEDKVSFQ KEQPSVAVSD ESFLTEVGDA KPGRQKDEVV        60
     IAVAPAFGKY QTKNIVGVPH KQILREVIAG IEEEGLKARV VRVFRSSDVA FVAVEGDKLS       120
     GSGICIGIQS RGTALIHQKD LQPLSNLELF PQAPLITLET YRAIGKNAAK YAKGESPNPV       180
     PMVNDQMARP KFQAKAALLH IKETKHVVQG KNAVELQVN                              219
//

If you have problems or comments...

PBIL Back to PBIL home page