(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1119

AL596167.LIN1119     Location/Qualifiers
FT   CDS             172436..172948
FT                   /transl_table=11
FT                   /gene="lin1119"
FT                   /note="similar to diol dehydrase (diol dehydratase) gamma
FT                   subunit (pddC)"
FT                   /db_xref="InterPro:IPR003207"
FT                   /db_xref="InterPro:IPR036091"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ2"
FT                   /protein_id="CAC96350.1"
FT                   /translation="MNQEALENMVRNILQEVNSGAVTTTTSQKASGDSLTVRDYPLGTK
FT                   RPELVKTASSKSLDDITLKSVLDGTIKPEDVRVTAETLKMQAQVARDAGRATLANNFER
FT                   AAELTVVPDERILEIYNAMRPYRSSREELLAIADELENVYQATICSNYVREAAQLYQER
FT                   KKLKGDN"
     MNQEALENMV RNILQEVNSG AVTTTTSQKA SGDSLTVRDY PLGTKRPELV KTASSKSLDD        60
     ITLKSVLDGT IKPEDVRVTA ETLKMQAQVA RDAGRATLAN NFERAAELTV VPDERILEIY       120
     NAMRPYRSSR EELLAIADEL ENVYQATICS NYVREAAQLY QERKKLKGDN                  170
//

If you have problems or comments...

PBIL Back to PBIL home page