(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1120

AL596167.LIN1120     Location/Qualifiers
FT   CDS             172993..174813
FT                   /transl_table=11
FT                   /gene="lin1120"
FT                   /note="similar to diol dehydratase-reactivating factor
FT                   large subunit "
FT                   /db_xref="GOA:Q92CQ1"
FT                   /db_xref="InterPro:IPR009191"
FT                   /db_xref="InterPro:IPR028975"
FT                   /db_xref="InterPro:IPR030994"
FT                   /db_xref="InterPro:IPR040916"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CQ1"
FT                   /protein_id="CAC96351.1"
FT                   /translation="MKYIAGIDIGNSTTEVALAILDSVNNAEFVASAITDTTGIKGTKQ
FT                   NLHGIFKALKLALEKVNATTADLAEIRINEATPVIGDVAMETITETIITESTMIGHNPK
FT                   TPGGLGMGSGITVHLDEVASKSKDTDYIVIIPKTVDFEDAAQQINDYTELGYQITAAIL
FT                   QADDGVLVHNRLNHKIPIVDEVGFIDKVPVDMLAAVEVAAPGKVIETISNPYGIATVFR
FT                   LSSDETKNIIPVARALIGNRSAVVIKTPEGDVKARTIPAGHIELQSGTRTQRVNVAEGS
FT                   EKIMQAIMSLPKLDNASGEPGTNIGGMLEKVRQTMAGLTDKLPADIFIQDLLAVDTFVP
FT                   VDVQGGLAGEFSMEQAVGIASMVKSDHLQMAAIASEIEQELNVTVKIGGAEAEAAILGA
FT                   LTTPGTNTPLAILDLGAGSTDASIINGKGEIIATHLAGAGDMVTMIIQSEIGLEDRYLA
FT                   EDIKKYPLAKVESIFHIRHEDGTVQFFDTPLSPSVFAKVVIVKPDGFVPIPGDVSIEKI
FT                   KLIRRSAKERVFVTNTIRALKYVSPTGNIRDIPFVVIVGGSALDFEIPQLITDALSHYS
FT                   LVAGRGNIRGQEGPRNAVATGLILSGGANV"
     MKYIAGIDIG NSTTEVALAI LDSVNNAEFV ASAITDTTGI KGTKQNLHGI FKALKLALEK        60
     VNATTADLAE IRINEATPVI GDVAMETITE TIITESTMIG HNPKTPGGLG MGSGITVHLD       120
     EVASKSKDTD YIVIIPKTVD FEDAAQQIND YTELGYQITA AILQADDGVL VHNRLNHKIP       180
     IVDEVGFIDK VPVDMLAAVE VAAPGKVIET ISNPYGIATV FRLSSDETKN IIPVARALIG       240
     NRSAVVIKTP EGDVKARTIP AGHIELQSGT RTQRVNVAEG SEKIMQAIMS LPKLDNASGE       300
     PGTNIGGMLE KVRQTMAGLT DKLPADIFIQ DLLAVDTFVP VDVQGGLAGE FSMEQAVGIA       360
     SMVKSDHLQM AAIASEIEQE LNVTVKIGGA EAEAAILGAL TTPGTNTPLA ILDLGAGSTD       420
     ASIINGKGEI IATHLAGAGD MVTMIIQSEI GLEDRYLAED IKKYPLAKVE SIFHIRHEDG       480
     TVQFFDTPLS PSVFAKVVIV KPDGFVPIPG DVSIEKIKLI RRSAKERVFV TNTIRALKYV       540
     SPTGNIRDIP FVVIVGGSAL DFEIPQLITD ALSHYSLVAG RGNIRGQEGP RNAVATGLIL       600
     SGGANV                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page