(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1122

AL596167.LIN1122     Location/Qualifiers
FT   CDS             175170..175607
FT                   /transl_table=11
FT                   /gene="lin1122"
FT                   /note="similar to Salmonella enterica PduK protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP9"
FT                   /protein_id="CAC96353.1"
FT                   /translation="MHQAIGIIEIKGLASAITVADTMAKVANIQIVDTEKAKGFGWITV
FT                   KVEGDVAAVNAALEAGEQTAIASDSFVAKKVIPRPGEEIFTVFLPKEEIVPEEPELIVE
FT                   TEDVAEPETPVEATCNLCHDPLCPRIKGDPRQDCIHFEEEK"
     MHQAIGIIEI KGLASAITVA DTMAKVANIQ IVDTEKAKGF GWITVKVEGD VAAVNAALEA        60
     GEQTAIASDS FVAKKVIPRP GEEIFTVFLP KEEIVPEEPE LIVETEDVAE PETPVEATCN       120
     LCHDPLCPRI KGDPRQDCIH FEEEK                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page