(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1124

AL596167.LIN1124     Location/Qualifiers
FT   CDS             175912..176547
FT                   /transl_table=11
FT                   /gene="lin1124"
FT                   /note="similar to Salmonella enterica PduL protein"
FT                   /db_xref="GOA:Q92CP7"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP7"
FT                   /protein_id="CAC96355.1"
FT                   /translation="MEREELKAIIKKIVTDKYGGAETEIPIGVSNRHIHLTEKDYNQLF
FT                   PNEPIQVKKWLKQPGEFAAEQTLTVVSERGELKRVRILGPLRKFSQVELSKTDARMLGM
FT                   KIPIRVSGDIEGTPGIKLVSKHNEIFLPKGAIVAKRHIHLPESVANEYGVKQGDEVSVL
FT                   VGSEIRSLVLNHCTIRVNNQFIPEMHIDTDEANAADIAGDSFAKIIKS"
     MEREELKAII KKIVTDKYGG AETEIPIGVS NRHIHLTEKD YNQLFPNEPI QVKKWLKQPG        60
     EFAAEQTLTV VSERGELKRV RILGPLRKFS QVELSKTDAR MLGMKIPIRV SGDIEGTPGI       120
     KLVSKHNEIF LPKGAIVAKR HIHLPESVAN EYGVKQGDEV SVLVGSEIRS LVLNHCTIRV       180
     NNQFIPEMHI DTDEANAADI AGDSFAKIIK S                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page