(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1125

AL596167.LIN1125     Location/Qualifiers
FT   CDS             176568..177407
FT                   /transl_table=11
FT                   /gene="lin1125"
FT                   /note="similar to ethanolamine utilization protein EutJ"
FT                   /db_xref="InterPro:IPR013366"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP6"
FT                   /protein_id="CAC96356.1"
FT                   /translation="MDILQTANERMEQLAALMNKDTKQKVSADQKVKVGVDLGTSSIVF
FT                   VVLDENNVPLFGAFEFADAVRDGLVVNYRESVEVVKRLKDRAEKSLGISLTHASGAIPP
FT                   GTIGNNKKVVANVIESAGMEALYTIDEPTAAAAVLDLKDGAVVDVGGGTTGISVFKDGD
FT                   VIYTADEPTGGTHMTLVLAGYYGVSVEEAEENKRAQKDSSEHFSVMRPVVEKMAEITRV
FT                   HLEKSPSEPLYIVGGASAYSQFKDTFESYLKMPVFQPNYPQYVTPLGIAMSSGSGNL"
     MDILQTANER MEQLAALMNK DTKQKVSADQ KVKVGVDLGT SSIVFVVLDE NNVPLFGAFE        60
     FADAVRDGLV VNYRESVEVV KRLKDRAEKS LGISLTHASG AIPPGTIGNN KKVVANVIES       120
     AGMEALYTID EPTAAAAVLD LKDGAVVDVG GGTTGISVFK DGDVIYTADE PTGGTHMTLV       180
     LAGYYGVSVE EAEENKRAQK DSSEHFSVMR PVVEKMAEIT RVHLEKSPSE PLYIVGGASA       240
     YSQFKDTFES YLKMPVFQPN YPQYVTPLGI AMSSGSGNL                              279
//

If you have problems or comments...

PBIL Back to PBIL home page