(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1127

AL596167.LIN1127     Location/Qualifiers
FT   CDS             177888..178151
FT                   /transl_table=11
FT                   /gene="lin1127"
FT                   /note="similar to carbon dioxide concentrating mechanism
FT                   protein "
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP4"
FT                   /protein_id="CAC96358.1"
FT                   /translation="MFMAKITGSVVSTKKEDSLTGKKLMIVQPIDANGEHVRSEEVACD
FT                   SVGAGIGEYVLVARGNAARSVFAEPNSAIDSAIIAIVDSFDK"
     MFMAKITGSV VSTKKEDSLT GKKLMIVQPI DANGEHVRSE EVACDSVGAG IGEYVLVARG        60
     NAARSVFAEP NSAIDSAIIA IVDSFDK                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page