(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1128

AL596167.LIN1128     Location/Qualifiers
FT   CDS             178166..179161
FT                   /transl_table=11
FT                   /gene="lin1128"
FT                   /product="hyghly similar to Salmonella enterica PduO
FT                   protein "
FT                   /db_xref="GOA:Q92CP3"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR009221"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP3"
FT                   /protein_id="CAC96359.1"
FT                   /translation="MSIYTKTGDKGTTALFDGNRVKKYDDRVETYGSFDELNAEISVAE
FT                   KFVTSHENKTLLRNVERQLFYVCAELATEDESALASKIVITEDDINELEKVIDAYTLKL
FT                   PKVDSFVLPGSSKAGAFLHSARTIARRAERLLVRFSEQTAVRNELLKFVNRLSDFLYIL
FT                   AREEDFRQMLDKATKLIVAKYLEQTEQKPSTTSDLSFSFCEKLMHQVQVVSEEVGVPVT
FT                   LAIVDAHGNARFNYRMEHALLVSAELATKKAYSAVAMKTSTEKLTEAVQPGAPLYQLET
FT                   LTNGDIVTFGGGVPIYGKDGAIIGGMGISGGSVEEDIHIAKKALSMIEKG"
     MSIYTKTGDK GTTALFDGNR VKKYDDRVET YGSFDELNAE ISVAEKFVTS HENKTLLRNV        60
     ERQLFYVCAE LATEDESALA SKIVITEDDI NELEKVIDAY TLKLPKVDSF VLPGSSKAGA       120
     FLHSARTIAR RAERLLVRFS EQTAVRNELL KFVNRLSDFL YILAREEDFR QMLDKATKLI       180
     VAKYLEQTEQ KPSTTSDLSF SFCEKLMHQV QVVSEEVGVP VTLAIVDAHG NARFNYRMEH       240
     ALLVSAELAT KKAYSAVAMK TSTEKLTEAV QPGAPLYQLE TLTNGDIVTF GGGVPIYGKD       300
     GAIIGGMGIS GGSVEEDIHI AKKALSMIEK G                                      331
//

If you have problems or comments...

PBIL Back to PBIL home page