(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1129

AL596167.LIN1129     Location/Qualifiers
FT   CDS             179168..180577
FT                   /transl_table=11
FT                   /gene="lin1129"
FT                   /note="similar to ethanolamine utilization protein EutE"
FT                   /db_xref="GOA:Q92CP2"
FT                   /db_xref="InterPro:IPR012408"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CP2"
FT                   /protein_id="CAC96360.1"
FT                   /translation="MESLELEQLVKKVLLEKLAEQKEVPTKTTTQGAKSGVFDTVDEAV
FT                   QAAVIAQNCYKEKSLEERRNVVKAIREALYPEIETIATRAVAETGMGNVTDKILKNTLA
FT                   IEKTPGVEDLYTEVATGDNGMTLYELSPYGVIGAVAPSTNPTETLICNSIGMLAAGNAV
FT                   FYSPHPGAKNISLWLIEKLNTIVRDSCGIDNLIVTVAKPSIQAAQEMMNHPKVPLLVIT
FT                   GGPGVVLQAMQSGKKVIGAGAGNPPSIVDETANIEKAAADIVDGASFDHNILCIAEKSV
FT                   VAVDSIADFLLFQMEKNGALHVTNPSDIQKLEKVAVTDKGVTNKKLVGKSATEILKEAG
FT                   IACDFTPRLIIVETEKSHPFATVELLMPIVPVVRVPDFDEALEVAIELEQGLHHTATMH
FT                   SQNISRLNKAARDMQTSIFVKNGPSFAGLGFRGEGSTTFTIATPTGEGTTTARHFARRR
FT                   RCVLTDGFSIR"
     MESLELEQLV KKVLLEKLAE QKEVPTKTTT QGAKSGVFDT VDEAVQAAVI AQNCYKEKSL        60
     EERRNVVKAI REALYPEIET IATRAVAETG MGNVTDKILK NTLAIEKTPG VEDLYTEVAT       120
     GDNGMTLYEL SPYGVIGAVA PSTNPTETLI CNSIGMLAAG NAVFYSPHPG AKNISLWLIE       180
     KLNTIVRDSC GIDNLIVTVA KPSIQAAQEM MNHPKVPLLV ITGGPGVVLQ AMQSGKKVIG       240
     AGAGNPPSIV DETANIEKAA ADIVDGASFD HNILCIAEKS VVAVDSIADF LLFQMEKNGA       300
     LHVTNPSDIQ KLEKVAVTDK GVTNKKLVGK SATEILKEAG IACDFTPRLI IVETEKSHPF       360
     ATVELLMPIV PVVRVPDFDE ALEVAIELEQ GLHHTATMHS QNISRLNKAA RDMQTSIFVK       420
     NGPSFAGLGF RGEGSTTFTI ATPTGEGTTT ARHFARRRRC VLTDGFSIR                   469
//

If you have problems or comments...

PBIL Back to PBIL home page