(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1134

AL596167.LIN1134     Location/Qualifiers
FT   CDS             184793..185668
FT                   /transl_table=11
FT                   /gene="lin1134"
FT                   /note="similar to Salmonella enterica PduX protein"
FT                   /db_xref="GOA:Q92CN7"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012363"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN7"
FT                   /protein_id="CAC96365.1"
FT                   /translation="MEIKATCPASCGELLQGFITGGEKLISYPINWYSEVTLSDKSGQN
FT                   SQGHTKAWLAFEVTCEYFGVTKKERPPISLLVKSTIPVAKGMASSTADIAATIGATAKW
FT                   LNKPITETEIAKLCLQLEPTDSTIFKSLTLFDHLKGSVIESSNWMPKLGVVVLEPLTVL
FT                   ETATYRQEDHHEQLLENEQQLAKAVQFFNQAAAQKSINLLGKAATVSAASNQIILPKPF
FT                   WNELLEVVSCLNLVGINVSHSGTVVGLLYELGKIDPLEILFELERRYVTTFYSRYYFRE
FT                   LVRGGVQIIS"
     MEIKATCPAS CGELLQGFIT GGEKLISYPI NWYSEVTLSD KSGQNSQGHT KAWLAFEVTC        60
     EYFGVTKKER PPISLLVKST IPVAKGMASS TADIAATIGA TAKWLNKPIT ETEIAKLCLQ       120
     LEPTDSTIFK SLTLFDHLKG SVIESSNWMP KLGVVVLEPL TVLETATYRQ EDHHEQLLEN       180
     EQQLAKAVQF FNQAAAQKSI NLLGKAATVS AASNQIILPK PFWNELLEVV SCLNLVGINV       240
     SHSGTVVGLL YELGKIDPLE ILFELERRYV TTFYSRYYFR ELVRGGVQII S                291
//

If you have problems or comments...

PBIL Back to PBIL home page