(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1137

AL596167.LIN1137     Location/Qualifiers
FT   CDS             188247..189704
FT                   /transl_table=11
FT                   /gene="lin1137"
FT                   /note="similar to two-component sensor histidine kinase"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR022066"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038424"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN4"
FT                   /protein_id="CAC96368.1"
FT                   /translation="MTKTIREMCLRYTDLAEYDIDELIHTAKSLSESSMYQDVDVFIDV
FT                   YNKLTSEALVIHHTPPKSTKSLYKNNVVGETALRSNEPGVLRTLETGMNSNDLLAKTQE
FT                   NVLIRQKVYPIRNKQRVIAVLILENDISAEIKAHFEIDNEETAYRDVSTTLSAMSKLTD
FT                   SITDQLDDAILIFDRNGILQQKNCAADQYYERLGYMENIQGMHYDNLSLDQMMFDAIMY
FT                   QIETGKQPVQLKKEVVIAGNYFIMKQIFVKEEDEQECRFILILHDVTDIKVKEAEIVSK
FT                   SVAIREIHHRVKNNLQSVVSLLRIQGRRSTSVEAQKVLNESVSRILAIAATHELLSKQM
FT                   EDGINLYMVIEAVAYNIERCCNDCPQVAVRMDIDKRIYLDSDRTVALALVMNELLQNSY
FT                   DHAFHPNESGEILLQIKEEKNIIHAEVSDNGHGFNVRKVSEKSLGLSIVKSYIKDKLRG
FT                   KVTIESNEHGTKTMFDFKYNSIHATKK"
     MTKTIREMCL RYTDLAEYDI DELIHTAKSL SESSMYQDVD VFIDVYNKLT SEALVIHHTP        60
     PKSTKSLYKN NVVGETALRS NEPGVLRTLE TGMNSNDLLA KTQENVLIRQ KVYPIRNKQR       120
     VIAVLILEND ISAEIKAHFE IDNEETAYRD VSTTLSAMSK LTDSITDQLD DAILIFDRNG       180
     ILQQKNCAAD QYYERLGYME NIQGMHYDNL SLDQMMFDAI MYQIETGKQP VQLKKEVVIA       240
     GNYFIMKQIF VKEEDEQECR FILILHDVTD IKVKEAEIVS KSVAIREIHH RVKNNLQSVV       300
     SLLRIQGRRS TSVEAQKVLN ESVSRILAIA ATHELLSKQM EDGINLYMVI EAVAYNIERC       360
     CNDCPQVAVR MDIDKRIYLD SDRTVALALV MNELLQNSYD HAFHPNESGE ILLQIKEEKN       420
     IIHAEVSDNG HGFNVRKVSE KSLGLSIVKS YIKDKLRGKV TIESNEHGTK TMFDFKYNSI       480
     HATKK                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page