(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1141

AL596167.LIN1141     Location/Qualifiers
FT   CDS             193546..194199
FT                   /transl_table=11
FT                   /gene="lin1141"
FT                   /note="similar to putative carboxysome structural protein
FT                   (eutL)"
FT                   /db_xref="GOA:Q92CN0"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR009193"
FT                   /db_xref="InterPro:IPR030983"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CN0"
FT                   /protein_id="CAC96372.1"
FT                   /translation="MKNDKLPASVLSVKVVSNVDNGLFKQLDLKPHQRSLGIITSDCDD
FT                   VTYTALDEATKAAEVDVVYAKSMYAGAGNASTKLAGEVIGIIAGPSPAEVKSGLSVAVD
FT                   FIENGASFVSANEDDSVPYFAHCVSRTGSFLSKEANVAEGQAIAYLIAPPLEAMYALDA
FT                   ALKAADVAIGTFYGPPSETNFGGALLTGSQSACKAACDAFKMAVENVAENPLQY"
     MKNDKLPASV LSVKVVSNVD NGLFKQLDLK PHQRSLGIIT SDCDDVTYTA LDEATKAAEV        60
     DVVYAKSMYA GAGNASTKLA GEVIGIIAGP SPAEVKSGLS VAVDFIENGA SFVSANEDDS       120
     VPYFAHCVSR TGSFLSKEAN VAEGQAIAYL IAPPLEAMYA LDAALKAADV AIGTFYGPPS       180
     ETNFGGALLT GSQSACKAAC DAFKMAVENV AENPLQY                                217
//

If you have problems or comments...

PBIL Back to PBIL home page