(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1142

AL596167.LIN1142     Location/Qualifiers
FT   CDS             194214..194711
FT                   /transl_table=11
FT                   /gene="lin1142"
FT                   /note="similar to putative carboxysome structural protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM9"
FT                   /protein_id="CAC96373.1"
FT                   /translation="MPNEALGLIEVTGFLGAVVAADTCLKAANVELIRCEVIKGGLTTV
FT                   ELTGDVGAVNAAVEAGKAATESLGCLISSHVIARMSEETKSLFVKAEQEIEETKEVIQE
FT                   VVEVKTTTDETEKKLREMKVIDLRKLAYTLDNVPIPKSKIKYANKDKLVHALKDIYGRS
FT                   EN"
     MPNEALGLIE VTGFLGAVVA ADTCLKAANV ELIRCEVIKG GLTTVELTGD VGAVNAAVEA        60
     GKAATESLGC LISSHVIARM SEETKSLFVK AEQEIEETKE VIQEVVEVKT TTDETEKKLR       120
     EMKVIDLRKL AYTLDNVPIP KSKIKYANKD KLVHALKDIY GRSEN                       165
//

If you have problems or comments...

PBIL Back to PBIL home page