(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1146

AL596167.LIN1146     Location/Qualifiers
FT   CDS             197421..198062
FT                   /transl_table=11
FT                   /gene="lin1146"
FT                   /note="similar to Salmonella enterica PduL protein"
FT                   /db_xref="GOA:Q92CM5"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM5"
FT                   /protein_id="CAC96377.1"
FT                   /translation="MNNELITSLIEEVTRRALLETGVEVEASGRHVHLDRETVDALFGP
FT                   GYELTHFRDLSQPGQYVCKERISIVGPKSVIHNVVILGPIRKKTQVEISATDGTALGIK
FT                   APVRESGDIAGTPGILLLSAKNSVQLTEGLIVAKRHIHMTPEDAAKQQVTQSEIVQVKI
FT                   NGDRPLIFDDVVVRISPDFATYMHIDYDEANACGFKKGIRGQIIKKTKAK"
     MNNELITSLI EEVTRRALLE TGVEVEASGR HVHLDRETVD ALFGPGYELT HFRDLSQPGQ        60
     YVCKERISIV GPKSVIHNVV ILGPIRKKTQ VEISATDGTA LGIKAPVRES GDIAGTPGIL       120
     LLSAKNSVQL TEGLIVAKRH IHMTPEDAAK QQVTQSEIVQ VKINGDRPLI FDDVVVRISP       180
     DFATYMHIDY DEANACGFKK GIRGQIIKKT KAK                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page