(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1148

AL596167.LIN1148     Location/Qualifiers
FT   CDS             198646..198915
FT                   /transl_table=11
FT                   /gene="lin1148"
FT                   /note="similar to carbon dioxide concentrating mechanism
FT                   protein"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM3"
FT                   /protein_id="CAC96379.1"
FT                   /translation="MQIGKVTGSLWATRKDEKLNGLKLLLVEICTDEVEDKRHSIVAAD
FT                   NAGAGNGDLVLVTTGSAARASTGDNTIPVDACIVGIIDSVERYG"
     MQIGKVTGSL WATRKDEKLN GLKLLLVEIC TDEVEDKRHS IVAADNAGAG NGDLVLVTTG        60
     SAARASTGDN TIPVDACIVG IIDSVERYG                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page