(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1149

AL596167.LIN1149     Location/Qualifiers
FT   CDS             198908..199453
FT                   /transl_table=11
FT                   /gene="lin1149"
FT                   /note="similar to Salmonella enterica PduT protein"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR011238"
FT                   /db_xref="InterPro:IPR013501"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM2"
FT                   /protein_id="CAC96380.1"
FT                   /translation="MAEQSLGILELRSISKGYEMADVFLKAGNVTLFTFRPTCPGKFLI
FT                   ILQGASGELTSAMQDAKEEAGKFHVSSYILHMAHEELLAFLNNKHPKVDVDAVGIIEIS
FT                   QLGAGLNAVNEALKKSAIHLKRMTLGASIGGKFVAVFTGEVSAIQEGMRILIETAEPKK
FT                   VIHHTVIPSPDELLKRYL"
     MAEQSLGILE LRSISKGYEM ADVFLKAGNV TLFTFRPTCP GKFLIILQGA SGELTSAMQD        60
     AKEEAGKFHV SSYILHMAHE ELLAFLNNKH PKVDVDAVGI IEISQLGAGL NAVNEALKKS       120
     AIHLKRMTLG ASIGGKFVAV FTGEVSAIQE GMRILIETAE PKKVIHHTVI PSPDELLKRY       180
     L                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page