(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1150

AL596167.LIN1150     Location/Qualifiers
FT   CDS             199469..200590
FT                   /transl_table=11
FT                   /gene="lin1150"
FT                   /note="similar to ethanolamine utilization protein EutH -
FT                   Escherichia coli"
FT                   /db_xref="GOA:Q92CM1"
FT                   /db_xref="InterPro:IPR007441"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM1"
FT                   /protein_id="CAC96381.1"
FT                   /translation="MSINEIIIYLMVIFMILGAIDKIIGNKFGLGAQFEEGIMAMGSLT
FT                   LAMVGIITLAPVLAKILSPIVVPIYTALGADPAMFATTLLANDMGGFALAQELALTPDA
FT                   GLFAGAILGSMMGPTIVFTIPVALGIIKKEDHKYLATGVLSGIITIPIGCLIGGLVAGF
FT                   SPIMIFKNLVPILLVAVLIMLGLWFKPEGMIKGFTIFGKGVVIVATIGLVAGAIQQLTG
FT                   LTIIPGIAPIGEGIEIVGGIALVLAGAFCLVFVITKVFNKPLMKMGKLLGMNEVAAAGM
FT                   VATLANSIPMFQMLKDMDERGKIINVAFAVSAAFVLGDHLGFTAGVAQDMIFPMIVGKL
FT                   VGGVTAVAVAIYMANRMMKKNKAKEQTAVKDNG"
     MSINEIIIYL MVIFMILGAI DKIIGNKFGL GAQFEEGIMA MGSLTLAMVG IITLAPVLAK        60
     ILSPIVVPIY TALGADPAMF ATTLLANDMG GFALAQELAL TPDAGLFAGA ILGSMMGPTI       120
     VFTIPVALGI IKKEDHKYLA TGVLSGIITI PIGCLIGGLV AGFSPIMIFK NLVPILLVAV       180
     LIMLGLWFKP EGMIKGFTIF GKGVVIVATI GLVAGAIQQL TGLTIIPGIA PIGEGIEIVG       240
     GIALVLAGAF CLVFVITKVF NKPLMKMGKL LGMNEVAAAG MVATLANSIP MFQMLKDMDE       300
     RGKIINVAFA VSAAFVLGDH LGFTAGVAQD MIFPMIVGKL VGGVTAVAVA IYMANRMMKK       360
     NKAKEQTAVK DNG                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page