(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1151

AL596167.LIN1151     Location/Qualifiers
FT   CDS             200583..201029
FT                   /transl_table=11
FT                   /gene="lin1151"
FT                   /note="similar to ethanolamine utilization protein EutQ"
FT                   /db_xref="InterPro:IPR010424"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CM0"
FT                   /protein_id="CAC96382.1"
FT                   /translation="MADISKELIEQLVKQVVLEKMGQSSKHVDPSGILSVKLPEVRVSE
FT                   EDRLDTGNPSDVVYTKDLVTLEESKRLGFGLMEMKDTTFDWFLDYDEVDYIIEGRLDVV
FT                   IDGRNVSAGPGELIFIPKGSQIKFSVTGEARFIYVTYPADWQSQ"
     MADISKELIE QLVKQVVLEK MGQSSKHVDP SGILSVKLPE VRVSEEDRLD TGNPSDVVYT        60
     KDLVTLEESK RLGFGLMEMK DTTFDWFLDY DEVDYIIEGR LDVVIDGRNV SAGPGELIFI       120
     PKGSQIKFSV TGEARFIYVT YPADWQSQ                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page