(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1155

AL596167.LIN1155     Location/Qualifiers
FT   CDS             204118..205065
FT                   /transl_table=11
FT                   /gene="lin1155"
FT                   /note="similar to cobalamine synthesis protein CbiB"
FT                   /db_xref="GOA:Q92CL6"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CL6"
FT                   /protein_id="CAC96386.1"
FT                   /translation="MSVLFYTISFILDFILGDPYSWPHPIKVIGNFIQLLTNALRKIFH
FT                   GKSLYFAGGLLFILTVGMTGIVSWLILYISAKIAFWLYAAVFIYLGYTTLAMTCLAKEA
FT                   RKIQRTLADGDLEAARVQVGMIVGRDTDKLTAEQISKATIETVAENTADGVIAPLFYLF
FT                   IGGPVLALMYKAVNTLDSMVGYKNEKYRAIGFVSAKMDDLANFIPARLSWFFLVIASFI
FT                   LKYDGRTAWRIGLRDRKNHTSPNCAYPEGAVAGALGITLGGTHEYFGETVVKPTIGSGT
FT                   KAVTQKEISQTIHLLYTASIIAFLIFISIHLILF"
     MSVLFYTISF ILDFILGDPY SWPHPIKVIG NFIQLLTNAL RKIFHGKSLY FAGGLLFILT        60
     VGMTGIVSWL ILYISAKIAF WLYAAVFIYL GYTTLAMTCL AKEARKIQRT LADGDLEAAR       120
     VQVGMIVGRD TDKLTAEQIS KATIETVAEN TADGVIAPLF YLFIGGPVLA LMYKAVNTLD       180
     SMVGYKNEKY RAIGFVSAKM DDLANFIPAR LSWFFLVIAS FILKYDGRTA WRIGLRDRKN       240
     HTSPNCAYPE GAVAGALGIT LGGTHEYFGE TVVKPTIGSG TKAVTQKEIS QTIHLLYTAS       300
     IIAFLIFISI HLILF                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page