(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1163

AL596167.LIN1163     Location/Qualifiers
FT   CDS             210491..211243
FT                   /transl_table=11
FT                   /gene="lin1163"
FT                   /note="similar to cobalamin biosynthesis J protein CbiJ "
FT                   /db_xref="GOA:Q92CK8"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK8"
FT                   /protein_id="CAC96394.1"
FT                   /translation="MIFVLGGTSDSLLISDWLTETKRPFILSVATDYGETLAKQHAEKV
FT                   FCGRLAKEAMLAKWQLEQIKLVIDATHPFATIVSETAMEACKEAGIPYIRFERTSEQTD
FT                   NTYLVDDINEACKVAAKLGQRIFLTTGSKNLPEFVAGLKQQHIIARILPVSDVIRSAEE
FT                   LGLVADQIIGMKGPFTKEANRTQLEMTQADVLITKESGKQGGFQEKLTAAAELNIPVIV
FT                   IRRKKLNYPIEINHLTELPEILTQLEVY"
     MIFVLGGTSD SLLISDWLTE TKRPFILSVA TDYGETLAKQ HAEKVFCGRL AKEAMLAKWQ        60
     LEQIKLVIDA THPFATIVSE TAMEACKEAG IPYIRFERTS EQTDNTYLVD DINEACKVAA       120
     KLGQRIFLTT GSKNLPEFVA GLKQQHIIAR ILPVSDVIRS AEELGLVADQ IIGMKGPFTK       180
     EANRTQLEMT QADVLITKES GKQGGFQEKL TAAAELNIPV IVIRRKKLNY PIEINHLTEL       240
     PEILTQLEVY                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page