(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1167

AL596167.LIN1167     Location/Qualifiers
FT   CDS             214206..214940
FT                   /transl_table=11
FT                   /gene="lin1167"
FT                   /note="similar to cobalamin biosynthesis protein M "
FT                   /db_xref="GOA:Q92CK4"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK4"
FT                   /protein_id="CAC96398.1"
FT                   /translation="MKKLWKFLPFVLIGVIYFTLTNPESAHAMHIMEGFLPVKWAVFWL
FT                   IVFIPFLVLGLIRIRKLIALDKNNKLLLALCAAFIFVLSALKIPSVTGSCSHPTGVGLA
FT                   TVMFGPLVVSVLGVIVLLFQALLLAHGGITTLGANAMSMAVIGPMVGFVVYKLARKLNC
FT                   NKSVSIFLCAMTADLATYLTTSVQLGVVFPDPASGMMASILKFMAIFCVTQVPIAIAEG
FT                   LLTVVMYNLISKNLPEKVAQLR"
     MKKLWKFLPF VLIGVIYFTL TNPESAHAMH IMEGFLPVKW AVFWLIVFIP FLVLGLIRIR        60
     KLIALDKNNK LLLALCAAFI FVLSALKIPS VTGSCSHPTG VGLATVMFGP LVVSVLGVIV       120
     LLFQALLLAH GGITTLGANA MSMAVIGPMV GFVVYKLARK LNCNKSVSIF LCAMTADLAT       180
     YLTTSVQLGV VFPDPASGMM ASILKFMAIF CVTQVPIAIA EGLLTVVMYN LISKNLPEKV       240
     AQLR                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page