(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1168

AL596167.LIN1168     Location/Qualifiers
FT   CDS             214937..215233
FT                   /transl_table=11
FT                   /gene="lin1168"
FT                   /note="similar to putative cobalt transport protein CbiN"
FT                   /db_xref="GOA:Q92CK3"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CK3"
FT                   /protein_id="CAC96399.1"
FT                   /translation="MKKININIILILLVVLLMVSPFFFNKTGEYGGSDGEAEAEITKID
FT                   PSYEPWFEPLYEPKSGEIESLLFTLQGCIGTGIIAYVIGVSRGKRKAENDVNH"
     MKKININIIL ILLVVLLMVS PFFFNKTGEY GGSDGEAEAE ITKIDPSYEP WFEPLYEPKS        60
     GEIESLLFTL QGCIGTGIIA YVIGVSRGKR KAENDVNH                                98
//

If you have problems or comments...

PBIL Back to PBIL home page