(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1170

AL596167.LIN1170     Location/Qualifiers
FT   CDS             215910..216716
FT                   /transl_table=11
FT                   /gene="lin1170"
FT                   /note="similar to cobalt transport ATP-binding protein
FT                   CbiO"
FT                   /db_xref="GOA:Q92CK1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CK1"
FT                   /protein_id="CAC96401.1"
FT                   /translation="MLKTEHISFQYEDGKQALTDVSIDLDKGNIIGLIGANGSGKSTLF
FT                   MQLLGINRPTSGTVYFEGKPLAYNKKALFALRKKVSIVFQDPDQQIFYSNVRDDVAFAL
FT                   RNLGISEKEVESRVTNVLETVGATEFQHKPVQYLSYGQKKRVAIAGALVLDTDWLLLDE
FT                   PTAGLDPIGKKIMMEIIERLAKQGKKILISSHDIDLIYEICDYVYMLKDGTVLTSGETS
FT                   EVFLEKSHIEQAGLVQPWLIKLHQQAGYPLFKKEADFFAHTGKVIN"
     MLKTEHISFQ YEDGKQALTD VSIDLDKGNI IGLIGANGSG KSTLFMQLLG INRPTSGTVY        60
     FEGKPLAYNK KALFALRKKV SIVFQDPDQQ IFYSNVRDDV AFALRNLGIS EKEVESRVTN       120
     VLETVGATEF QHKPVQYLSY GQKKRVAIAG ALVLDTDWLL LDEPTAGLDP IGKKIMMEII       180
     ERLAKQGKKI LISSHDIDLI YEICDYVYML KDGTVLTSGE TSEVFLEKSH IEQAGLVQPW       240
     LIKLHQQAGY PLFKKEADFF AHTGKVIN                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page