(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1172

AL596167.LIN1172     Location/Qualifiers
FT   CDS             218215..218781
FT                   /transl_table=11
FT                   /gene="lin1172"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q92CJ9"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CJ9"
FT                   /protein_id="CAC96403.1"
FT                   /translation="MRIYTKTGDKGMTRIIGGSKVSKDNIRINAYGTLDELNSLIGYTI
FT                   TTLGNEPEIQAELEQIQQQLFDAGGDLATEEGKRDYKLTAEPVAWLEDRIDIYADEPPE
FT                   IEKFILPGGTQAASLLHMARTVARRAEREIVGMLKIASTNQEVLKYVNRLSDYFFAVAR
FT                   VVNYRAGETDIFYKNSELVFRNKKK"
     MRIYTKTGDK GMTRIIGGSK VSKDNIRINA YGTLDELNSL IGYTITTLGN EPEIQAELEQ        60
     IQQQLFDAGG DLATEEGKRD YKLTAEPVAW LEDRIDIYAD EPPEIEKFIL PGGTQAASLL       120
     HMARTVARRA EREIVGMLKI ASTNQEVLKY VNRLSDYFFA VARVVNYRAG ETDIFYKNSE       180
     LVFRNKKK                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page