(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1176

AL596167.LIN1176     Location/Qualifiers
FT   CDS             220406..220717
FT                   /transl_table=11
FT                   /gene="lin1176"
FT                   /note="similar to unknown protein"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CJ5"
FT                   /protein_id="CAC96407.1"
FT                   /translation="MDEKLRKTYLPMTETAFYILLSLVKPKHGYAIIENVAQMTNERIK
FT                   LGPGTIYGSLSKMNKDNLIQIIQEESNRKIYQITEIGAEVLQLEKTRIEELYRNSREV"
     MDEKLRKTYL PMTETAFYIL LSLVKPKHGY AIIENVAQMT NERIKLGPGT IYGSLSKMNK        60
     DNLIQIIQEE SNRKIYQITE IGAEVLQLEK TRIEELYRNS REV                         103
//

If you have problems or comments...

PBIL Back to PBIL home page