(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1183

AL596167.LIN1183     Location/Qualifiers
FT   CDS             226255..226578
FT                   /transl_table=11
FT                   /gene="lin1183"
FT                   /note="similar to unknown protein"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP07"
FT                   /protein_id="CAC96414.1"
FT                   /translation="MTDAHTVCPKFESAFQLLGKRWTGLIINVLLTGPKRFKQVAAEIP
FT                   QMSDRVLAERLKELEEMDICLRQVYPETPVRIEYELTEKGKALQEVMLEVQCWADKWVE
FT                   VPN"
     MTDAHTVCPK FESAFQLLGK RWTGLIINVL LTGPKRFKQV AAEIPQMSDR VLAERLKELE        60
     EMDICLRQVY PETPVRIEYE LTEKGKALQE VMLEVQCWAD KWVEVPN                     107
//

If you have problems or comments...

PBIL Back to PBIL home page