(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1189

AL596167.LIN1189     Location/Qualifiers
FT   CDS             235249..238449
FT                   /transl_table=11
FT                   /gene="lin1189"
FT                   /note="similar to transporter, (to B. subtilis YdgH
FT                   protein)"
FT                   /db_xref="GOA:Q92CI2"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CI2"
FT                   /protein_id="CAC96420.1"
FT                   /translation="MKWIMKLRWAILAFWLAAAVVLMFIAPPMADLVREKGELKLPDGY
FT                   PSSLATEMQKKHNPDDKGSAYIAVYTADHKLTGTELNNIKKSLDSIDKNKDELHVTNVV
FT                   SSFNQPELKDKFLSKDGKTMVASLTVDDTDASVKSIRNALDKKMDVKGVDTYLTGNKLI
FT                   QEDVVQGSEDGLHKTEGITVVFILVVLFLVFRSAVAPFIPLLTVGISYLVAQSTVAFLI
FT                   DIFNFPVSTYTQIFMVCIMFGIGTDYCILLMSRFKEEMGAGLDPRESVHATYRTAGKTV
FT                   IYSGVAVLVAFTSLYFVQFDLYRSAVAVGVGIVVLLAALYTLVPFFMSTLGTHLFWPLN
FT                   KNISHKENKVWGAAGKFTFARPWIALLIVAAITLPPILLHTGTESFNSLDEISDKYPSK
FT                   KGFEIVSDSFGAGQVAPTQVFIENDDNMRTTEYIAQIEKISDDLSHLKGIDMVMSASRP
FT                   AGKRVDDIYIKNQAGQVNDGVGQATDGVGEVKKGLDSASSELKKSEPALDKAVAGVGDL
FT                   QKGTVATEQGINQLQAALAQIQIGIESGATGAGDLKQGVAEAKSQLASLQNGEAQIQAG
FT                   YAEIQKNLQNVAEQLKGFGNPNSPAIDTSKLEAQFKKIGESFQTFAAAHPEVRNDPKFQ
FT                   KLAADIQGLQTAGNELKTTAGQQMAALQAKMKELNQGIQQLATAMNQLNEQSKQISDGL
FT                   SAFGTGLGQIETGLDQLENGLNQAADGQGQVVSKMPEISNALSQIAAGQGALKEGFAGI
FT                   SGQMGELTNGLTSGADGLGKVESGLNTANGLIDDWSKVPYASSGIYVPDALLKNADFQK
FT                   VLDQYISSDGKLATINVILTKNPYSNGAMDSIDDINEQLAASMKGTKLENAKIGIGGMT
FT                   SANYDTRDMSTADYHLVLVIVLASVFVTLVIVLRSLVMPIYLIASLVLTYFAALGFAEI
FT                   IFMRILGYSGLTWATPFFGFVVLVALGIDYSIFLMSRFNEYNGLSVRDRMIKAMKNMGG
FT                   VIFSAVIILGGTFAAMMPAGVLSLLEIATVVLIGLVLYAIVILPLFVPVMVKLFGRGNW
FT                   WPFITRKGDHQENVPPKK"
     MKWIMKLRWA ILAFWLAAAV VLMFIAPPMA DLVREKGELK LPDGYPSSLA TEMQKKHNPD        60
     DKGSAYIAVY TADHKLTGTE LNNIKKSLDS IDKNKDELHV TNVVSSFNQP ELKDKFLSKD       120
     GKTMVASLTV DDTDASVKSI RNALDKKMDV KGVDTYLTGN KLIQEDVVQG SEDGLHKTEG       180
     ITVVFILVVL FLVFRSAVAP FIPLLTVGIS YLVAQSTVAF LIDIFNFPVS TYTQIFMVCI       240
     MFGIGTDYCI LLMSRFKEEM GAGLDPRESV HATYRTAGKT VIYSGVAVLV AFTSLYFVQF       300
     DLYRSAVAVG VGIVVLLAAL YTLVPFFMST LGTHLFWPLN KNISHKENKV WGAAGKFTFA       360
     RPWIALLIVA AITLPPILLH TGTESFNSLD EISDKYPSKK GFEIVSDSFG AGQVAPTQVF       420
     IENDDNMRTT EYIAQIEKIS DDLSHLKGID MVMSASRPAG KRVDDIYIKN QAGQVNDGVG       480
     QATDGVGEVK KGLDSASSEL KKSEPALDKA VAGVGDLQKG TVATEQGINQ LQAALAQIQI       540
     GIESGATGAG DLKQGVAEAK SQLASLQNGE AQIQAGYAEI QKNLQNVAEQ LKGFGNPNSP       600
     AIDTSKLEAQ FKKIGESFQT FAAAHPEVRN DPKFQKLAAD IQGLQTAGNE LKTTAGQQMA       660
     ALQAKMKELN QGIQQLATAM NQLNEQSKQI SDGLSAFGTG LGQIETGLDQ LENGLNQAAD       720
     GQGQVVSKMP EISNALSQIA AGQGALKEGF AGISGQMGEL TNGLTSGADG LGKVESGLNT       780
     ANGLIDDWSK VPYASSGIYV PDALLKNADF QKVLDQYISS DGKLATINVI LTKNPYSNGA       840
     MDSIDDINEQ LAASMKGTKL ENAKIGIGGM TSANYDTRDM STADYHLVLV IVLASVFVTL       900
     VIVLRSLVMP IYLIASLVLT YFAALGFAEI IFMRILGYSG LTWATPFFGF VVLVALGIDY       960
     SIFLMSRFNE YNGLSVRDRM IKAMKNMGGV IFSAVIILGG TFAAMMPAGV LSLLEIATVV      1020
     LIGLVLYAIV ILPLFVPVMV KLFGRGNWWP FITRKGDHQE NVPPKK                     1066
//

If you have problems or comments...

PBIL Back to PBIL home page